Anti CALCOCO2 pAb (ATL-HPA023019 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023019-25

• 
• 

Protein Description: calcium binding and coiled-coil domain 2
Gene Name: CALCOCO2
Alternative Gene Name: MGC17318, NDP52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006056: 60%, ENSRNOG00000052883: 56%
Entrez Gene ID: 10241
Uniprot ID: Q13137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSD
• Gene Sequence: YYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSD
• Gene ID - Mouse: ENSMUSG00000006056
• Gene ID - Rat: ENSRNOG00000052883
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.