Anti C8orf58 pAb (ATL-HPA028286)

Atlas Antibodies

SKU: ATL-HPA028286-25

• 
• 

Protein Description: chromosome 8 open reading frame 58
Gene Name: C8orf58
Alternative Gene Name: FLJ34715
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044551: 57%, ENSRNOG00000008351: 60%
Entrez Gene ID: 541565
Uniprot ID: Q8NAV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEQMARLQQLYLQLRIQRPPGDPGEEESTRAPLPSPLHTPGNRGQGPWELLSQTEHTGAKAASPPKVEVPSANPPRLPET
• Gene Sequence: LEQMARLQQLYLQLRIQRPPGDPGEEESTRAPLPSPLHTPGNRGQGPWELLSQTEHTGAKAASPPKVEVPSANPPRLPET
• Gene ID - Mouse: ENSMUSG00000044551
• Gene ID - Rat: ENSRNOG00000008351
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.