Anti C8orf58 pAb (ATL-HPA028286)

Atlas Antibodies

Catalog No.:
ATL-HPA028286-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 8 open reading frame 58
Gene Name: C8orf58
Alternative Gene Name: FLJ34715
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044551: 57%, ENSRNOG00000008351: 60%
Entrez Gene ID: 541565
Uniprot ID: Q8NAV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEQMARLQQLYLQLRIQRPPGDPGEEESTRAPLPSPLHTPGNRGQGPWELLSQTEHTGAKAASPPKVEVPSANPPRLPET
Gene Sequence LEQMARLQQLYLQLRIQRPPGDPGEEESTRAPLPSPLHTPGNRGQGPWELLSQTEHTGAKAASPPKVEVPSANPPRLPET
Gene ID - Mouse ENSMUSG00000044551
Gene ID - Rat ENSRNOG00000008351
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C8orf58 pAb (ATL-HPA028286)
Datasheet Anti C8orf58 pAb (ATL-HPA028286) Datasheet (External Link)
Vendor Page Anti C8orf58 pAb (ATL-HPA028286) at Atlas Antibodies

Documents & Links for Anti C8orf58 pAb (ATL-HPA028286)
Datasheet Anti C8orf58 pAb (ATL-HPA028286) Datasheet (External Link)
Vendor Page Anti C8orf58 pAb (ATL-HPA028286)