Anti C4orf36 pAb (ATL-HPA057434)

Atlas Antibodies

Catalog No.: ATL-HPA057434-25

Protein Description: chromosome 4 open reading frame 36
Gene Name: C4orf36
Alternative Gene Name: MGC26744
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029320: 53%, ENSRNOG00000060245: 51%
Entrez Gene ID: 132989
Uniprot ID: Q96KX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLTKCTTIKDGLLPSAESIKLEREYEVKRLCKLKCQENTSKEIQLLLRERPAGLRRP
• Gene Sequence: QLTKCTTIKDGLLPSAESIKLEREYEVKRLCKLKCQENTSKEIQLLLRERPAGLRRP
• Gene ID - Mouse: ENSMUSG00000029320
• Gene ID - Rat: ENSRNOG00000060245
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.