Anti C4orf36 pAb (ATL-HPA057434)

Atlas Antibodies

Catalog No.:
ATL-HPA057434-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 4 open reading frame 36
Gene Name: C4orf36
Alternative Gene Name: MGC26744
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029320: 53%, ENSRNOG00000060245: 51%
Entrez Gene ID: 132989
Uniprot ID: Q96KX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLTKCTTIKDGLLPSAESIKLEREYEVKRLCKLKCQENTSKEIQLLLRERPAGLRRP
Gene Sequence QLTKCTTIKDGLLPSAESIKLEREYEVKRLCKLKCQENTSKEIQLLLRERPAGLRRP
Gene ID - Mouse ENSMUSG00000029320
Gene ID - Rat ENSRNOG00000060245
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C4orf36 pAb (ATL-HPA057434)
Datasheet Anti C4orf36 pAb (ATL-HPA057434) Datasheet (External Link)
Vendor Page Anti C4orf36 pAb (ATL-HPA057434) at Atlas Antibodies

Documents & Links for Anti C4orf36 pAb (ATL-HPA057434)
Datasheet Anti C4orf36 pAb (ATL-HPA057434) Datasheet (External Link)
Vendor Page Anti C4orf36 pAb (ATL-HPA057434)