Anti C4orf36 pAb (ATL-HPA057434)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057434-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: C4orf36
Alternative Gene Name: MGC26744
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029320: 53%, ENSRNOG00000060245: 51%
Entrez Gene ID: 132989
Uniprot ID: Q96KX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QLTKCTTIKDGLLPSAESIKLEREYEVKRLCKLKCQENTSKEIQLLLRERPAGLRRP |
| Gene Sequence | QLTKCTTIKDGLLPSAESIKLEREYEVKRLCKLKCQENTSKEIQLLLRERPAGLRRP |
| Gene ID - Mouse | ENSMUSG00000029320 |
| Gene ID - Rat | ENSRNOG00000060245 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C4orf36 pAb (ATL-HPA057434) | |
| Datasheet | Anti C4orf36 pAb (ATL-HPA057434) Datasheet (External Link) |
| Vendor Page | Anti C4orf36 pAb (ATL-HPA057434) at Atlas Antibodies |
| Documents & Links for Anti C4orf36 pAb (ATL-HPA057434) | |
| Datasheet | Anti C4orf36 pAb (ATL-HPA057434) Datasheet (External Link) |
| Vendor Page | Anti C4orf36 pAb (ATL-HPA057434) |