Anti C2CD2 pAb (ATL-HPA030924)

Atlas Antibodies

SKU: ATL-HPA030924-25

• 
• 

Protein Description: C2 calcium-dependent domain containing 2
Gene Name: C2CD2
Alternative Gene Name: C21orf25, C21orf258, DKFZP586F0422, TMEM24L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045975: 73%, ENSRNOG00000001621: 72%
Entrez Gene ID: 25966
Uniprot ID: Q9Y426
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKSKELHLQISEAGRSSEGLLATATVPLDLFKKQPSGPQSFTLTSGSACGSSVLGSVTAEFSYMEPGELKSWPIP
• Gene Sequence: AKSKELHLQISEAGRSSEGLLATATVPLDLFKKQPSGPQSFTLTSGSACGSSVLGSVTAEFSYMEPGELKSWPIP
• Gene ID - Mouse: ENSMUSG00000045975
• Gene ID - Rat: ENSRNOG00000001621
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.