Anti C2CD2 pAb (ATL-HPA030924)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030924-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: C2CD2
Alternative Gene Name: C21orf25, C21orf258, DKFZP586F0422, TMEM24L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045975: 73%, ENSRNOG00000001621: 72%
Entrez Gene ID: 25966
Uniprot ID: Q9Y426
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AKSKELHLQISEAGRSSEGLLATATVPLDLFKKQPSGPQSFTLTSGSACGSSVLGSVTAEFSYMEPGELKSWPIP |
| Gene Sequence | AKSKELHLQISEAGRSSEGLLATATVPLDLFKKQPSGPQSFTLTSGSACGSSVLGSVTAEFSYMEPGELKSWPIP |
| Gene ID - Mouse | ENSMUSG00000045975 |
| Gene ID - Rat | ENSRNOG00000001621 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C2CD2 pAb (ATL-HPA030924) | |
| Datasheet | Anti C2CD2 pAb (ATL-HPA030924) Datasheet (External Link) |
| Vendor Page | Anti C2CD2 pAb (ATL-HPA030924) at Atlas Antibodies |
| Documents & Links for Anti C2CD2 pAb (ATL-HPA030924) | |
| Datasheet | Anti C2CD2 pAb (ATL-HPA030924) Datasheet (External Link) |
| Vendor Page | Anti C2CD2 pAb (ATL-HPA030924) |