Anti C19orf71 pAb (ATL-HPA048654)

Atlas Antibodies

SKU: ATL-HPA048654-100

• 
• 
• 

Protein Description: chromosome 19 open reading frame 71
Gene Name: C19orf71
Alternative Gene Name: LOC100128569
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020234: 55%, ENSRNOG00000039861: 59%
Entrez Gene ID: 100128569
Uniprot ID: A6NCJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AWEAWYNLPRALASPFREAYNRWHSCYQHRECSMPSAYTQHLRETAWHDPIVPAQYQAPSTRWGSALWKDRPI
• Gene Sequence: AWEAWYNLPRALASPFREAYNRWHSCYQHRECSMPSAYTQHLRETAWHDPIVPAQYQAPSTRWGSALWKDRPI
• Gene ID - Mouse: ENSMUSG00000020234
• Gene ID - Rat: ENSRNOG00000039861
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.