Anti C17orf99 pAb (ATL-HPA029655)

Atlas Antibodies

SKU: ATL-HPA029655-25

• 

Protein Description: chromosome 17 open reading frame 99
Gene Name: C17orf99
Alternative Gene Name: GLPG464, UNQ464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075302: 26%, ENSRNOG00000054039: 23%
Entrez Gene ID: 100141515
Uniprot ID: Q6UX52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FSFLPSQTSDWFWCQAANNANVQHSALTVVPPGGDQKMEDWQGPLESPILALPLYRSTRRLSEEEFGGFRIGNGEVRGRKAAAM
• Gene Sequence: FSFLPSQTSDWFWCQAANNANVQHSALTVVPPGGDQKMEDWQGPLESPILALPLYRSTRRLSEEEFGGFRIGNGEVRGRKAAAM
• Gene ID - Mouse: ENSMUSG00000075302
• Gene ID - Rat: ENSRNOG00000054039
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.