Anti C17orf99 pAb (ATL-HPA029655)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029655-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C17orf99
Alternative Gene Name: GLPG464, UNQ464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075302: 26%, ENSRNOG00000054039: 23%
Entrez Gene ID: 100141515
Uniprot ID: Q6UX52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FSFLPSQTSDWFWCQAANNANVQHSALTVVPPGGDQKMEDWQGPLESPILALPLYRSTRRLSEEEFGGFRIGNGEVRGRKAAAM |
Gene Sequence | FSFLPSQTSDWFWCQAANNANVQHSALTVVPPGGDQKMEDWQGPLESPILALPLYRSTRRLSEEEFGGFRIGNGEVRGRKAAAM |
Gene ID - Mouse | ENSMUSG00000075302 |
Gene ID - Rat | ENSRNOG00000054039 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C17orf99 pAb (ATL-HPA029655) | |
Datasheet | Anti C17orf99 pAb (ATL-HPA029655) Datasheet (External Link) |
Vendor Page | Anti C17orf99 pAb (ATL-HPA029655) at Atlas Antibodies |
Documents & Links for Anti C17orf99 pAb (ATL-HPA029655) | |
Datasheet | Anti C17orf99 pAb (ATL-HPA029655) Datasheet (External Link) |
Vendor Page | Anti C17orf99 pAb (ATL-HPA029655) |