Anti C17orf99 pAb (ATL-HPA029655)

Atlas Antibodies

Catalog No.:
ATL-HPA029655-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 17 open reading frame 99
Gene Name: C17orf99
Alternative Gene Name: GLPG464, UNQ464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075302: 26%, ENSRNOG00000054039: 23%
Entrez Gene ID: 100141515
Uniprot ID: Q6UX52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FSFLPSQTSDWFWCQAANNANVQHSALTVVPPGGDQKMEDWQGPLESPILALPLYRSTRRLSEEEFGGFRIGNGEVRGRKAAAM
Gene Sequence FSFLPSQTSDWFWCQAANNANVQHSALTVVPPGGDQKMEDWQGPLESPILALPLYRSTRRLSEEEFGGFRIGNGEVRGRKAAAM
Gene ID - Mouse ENSMUSG00000075302
Gene ID - Rat ENSRNOG00000054039
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C17orf99 pAb (ATL-HPA029655)
Datasheet Anti C17orf99 pAb (ATL-HPA029655) Datasheet (External Link)
Vendor Page Anti C17orf99 pAb (ATL-HPA029655) at Atlas Antibodies

Documents & Links for Anti C17orf99 pAb (ATL-HPA029655)
Datasheet Anti C17orf99 pAb (ATL-HPA029655) Datasheet (External Link)
Vendor Page Anti C17orf99 pAb (ATL-HPA029655)