Anti C15orf48 pAb (ATL-HPA012943 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA012943-25

• 

Protein Description: chromosome 15 open reading frame 48
Gene Name: C15orf48
Alternative Gene Name: NMES1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110868: 85%, ENSRNOG00000050251: 79%
Entrez Gene ID: 84419
Uniprot ID: Q9C002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQ
• Gene Sequence: TDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQ
• Gene ID - Mouse: ENSMUSG00000110868
• Gene ID - Rat: ENSRNOG00000050251
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C15orf48 pAb (ATL-HPA012943 w/enhanced validation) – 1 Found

Lee, Cheryl Q E; Kerouanton, Baptiste; Chothani, Sonia; Zhang, Shan; Chen, Ying; Mantri, Chinmay Kumar; Hock, Daniella Helena; Lim, Radiance; Nadkarni, Rhea; Huynh, Vinh Thang; Lim, Daryl; Chew, Wei Leong; Zhong, Franklin L; Stroud, David Arthur; Schafer, Sebastian; Tergaonkar, Vinay; St John, Ashley L; Rackham, Owen J L; Ho, Lena. Coding and non-coding roles of MOCCI (C15ORF48) coordinate to regulate host inflammation and immunity. Nature Communications. 2021;12(1):2130.