Anti C14orf2 pAb (ATL-HPA058978 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA058978-25

Protein Description: chromosome 14 open reading frame 2
Gene Name: C14orf2
Alternative Gene Name: MP68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021290: 81%, ENSRNOG00000032130: 76%
Entrez Gene ID: 9556
Uniprot ID: P56378
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH
• Gene Sequence: PMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH
• Gene ID - Mouse: ENSMUSG00000021290
• Gene ID - Rat: ENSRNOG00000032130
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.