Anti C14orf2 pAb (ATL-HPA058978 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA058978-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 14 open reading frame 2
Gene Name: C14orf2
Alternative Gene Name: MP68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021290: 81%, ENSRNOG00000032130: 76%
Entrez Gene ID: 9556
Uniprot ID: P56378
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH
Gene Sequence PMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH
Gene ID - Mouse ENSMUSG00000021290
Gene ID - Rat ENSRNOG00000032130
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C14orf2 pAb (ATL-HPA058978 w/enhanced validation)
Datasheet Anti C14orf2 pAb (ATL-HPA058978 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C14orf2 pAb (ATL-HPA058978 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C14orf2 pAb (ATL-HPA058978 w/enhanced validation)
Datasheet Anti C14orf2 pAb (ATL-HPA058978 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C14orf2 pAb (ATL-HPA058978 w/enhanced validation)