Anti C11orf63 pAb (ATL-HPA077658 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077658-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: C11orf63
Alternative Gene Name: FLJ23554
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032023: 71%, ENSRNOG00000008138: 72%
Entrez Gene ID: 79864
Uniprot ID: Q6NUN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YAKQVKEYNMKTLSILSKPQTEKTQKKSAIPRQKALEYAKTIPKPKPSNLTHQASKEQKNPTYAGKEESLPEISLLEI |
| Gene Sequence | YAKQVKEYNMKTLSILSKPQTEKTQKKSAIPRQKALEYAKTIPKPKPSNLTHQASKEQKNPTYAGKEESLPEISLLEI |
| Gene ID - Mouse | ENSMUSG00000032023 |
| Gene ID - Rat | ENSRNOG00000008138 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C11orf63 pAb (ATL-HPA077658 w/enhanced validation) | |
| Datasheet | Anti C11orf63 pAb (ATL-HPA077658 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C11orf63 pAb (ATL-HPA077658 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti C11orf63 pAb (ATL-HPA077658 w/enhanced validation) | |
| Datasheet | Anti C11orf63 pAb (ATL-HPA077658 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C11orf63 pAb (ATL-HPA077658 w/enhanced validation) |