Anti C11orf49 pAb (ATL-HPA040280)

Atlas Antibodies

Catalog No.:
ATL-HPA040280-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 49
Gene Name: C11orf49
Alternative Gene Name: FLJ22210, MGC4707
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040591: 91%, ENSRNOG00000014798: 90%
Entrez Gene ID: 79096
Uniprot ID: Q9H6J7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VIVPTSSSGQHRQRPALGGAGTLEGVEASLFYQCLENLCDRHKYSCPPPALVKEALSNVQRLTFYGFLMALSKHRGINQAL
Gene Sequence VIVPTSSSGQHRQRPALGGAGTLEGVEASLFYQCLENLCDRHKYSCPPPALVKEALSNVQRLTFYGFLMALSKHRGINQAL
Gene ID - Mouse ENSMUSG00000040591
Gene ID - Rat ENSRNOG00000014798
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C11orf49 pAb (ATL-HPA040280)
Datasheet Anti C11orf49 pAb (ATL-HPA040280) Datasheet (External Link)
Vendor Page Anti C11orf49 pAb (ATL-HPA040280) at Atlas Antibodies

Documents & Links for Anti C11orf49 pAb (ATL-HPA040280)
Datasheet Anti C11orf49 pAb (ATL-HPA040280) Datasheet (External Link)
Vendor Page Anti C11orf49 pAb (ATL-HPA040280)