Anti BSG pAb (ATL-HPA074870)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074870-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: BSG
Alternative Gene Name: CD147, EMMPRIN, OK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023175: 79%, ENSRNOG00000008414: 83%
Entrez Gene ID: 682
Uniprot ID: P35613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGT |
| Gene Sequence | EIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGT |
| Gene ID - Mouse | ENSMUSG00000023175 |
| Gene ID - Rat | ENSRNOG00000008414 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BSG pAb (ATL-HPA074870) | |
| Datasheet | Anti BSG pAb (ATL-HPA074870) Datasheet (External Link) |
| Vendor Page | Anti BSG pAb (ATL-HPA074870) at Atlas Antibodies |
| Documents & Links for Anti BSG pAb (ATL-HPA074870) | |
| Datasheet | Anti BSG pAb (ATL-HPA074870) Datasheet (External Link) |
| Vendor Page | Anti BSG pAb (ATL-HPA074870) |