Anti BSG pAb (ATL-HPA074870)

Atlas Antibodies

Catalog No.: ATL-HPA074870-25

Protein Description: basigin (Ok blood group)
Gene Name: BSG
Alternative Gene Name: CD147, EMMPRIN, OK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023175: 79%, ENSRNOG00000008414: 83%
Entrez Gene ID: 682
Uniprot ID: P35613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGT
• Gene Sequence: EIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGT
• Gene ID - Mouse: ENSMUSG00000023175
• Gene ID - Rat: ENSRNOG00000008414
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.