Anti BNC2 pAb (ATL-HPA018525)

Atlas Antibodies

Catalog No.:
ATL-HPA018525-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: basonuclin 2
Gene Name: BNC2
Alternative Gene Name: BSN2, FLJ20043
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028487: 99%, ENSRNOG00000006553: 96%
Entrez Gene ID: 54796
Uniprot ID: Q6ZN30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YENESESSEPKLGEESMEGDEHIHSEVSEKVLMNSERPDENHSEPSHQDVIKVKEEFTDPTYDMFYMSQYGLYNGGGASMAALHESFTSSLNYGSPQKFSPEGDLCSSPDPKICYVCKKSFKSSYSVK
Gene Sequence YENESESSEPKLGEESMEGDEHIHSEVSEKVLMNSERPDENHSEPSHQDVIKVKEEFTDPTYDMFYMSQYGLYNGGGASMAALHESFTSSLNYGSPQKFSPEGDLCSSPDPKICYVCKKSFKSSYSVK
Gene ID - Mouse ENSMUSG00000028487
Gene ID - Rat ENSRNOG00000006553
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BNC2 pAb (ATL-HPA018525)
Datasheet Anti BNC2 pAb (ATL-HPA018525) Datasheet (External Link)
Vendor Page Anti BNC2 pAb (ATL-HPA018525) at Atlas Antibodies

Documents & Links for Anti BNC2 pAb (ATL-HPA018525)
Datasheet Anti BNC2 pAb (ATL-HPA018525) Datasheet (External Link)
Vendor Page Anti BNC2 pAb (ATL-HPA018525)
Citations for Anti BNC2 pAb (ATL-HPA018525) – 3 Found
La Manno, Gioele; Gyllborg, Daniel; Codeluppi, Simone; Nishimura, Kaneyasu; Salto, Carmen; Zeisel, Amit; Borm, Lars E; Stott, Simon R W; Toledo, Enrique M; Villaescusa, J Carlos; Lönnerberg, Peter; Ryge, Jesper; Barker, Roger A; Arenas, Ernest; Linnarsson, Sten. Molecular Diversity of Midbrain Development in Mouse, Human, and Stem Cells. Cell. 2016;167(2):566-580.e19.  PubMed
Cesaratto, Laura; Grisard, Eleonora; Coan, Michela; Zandonà, Luigi; De Mattia, Elena; Poletto, Elena; Cecchin, Erika; Puglisi, Fabio; Canzonieri, Vincenzo; Mucignat, Maria Teresa; Zucchetto, Antonella; Stocco, Gabriele; Colombatti, Alfonso; Nicoloso, Milena S; Spizzo, Riccardo. BNC2 is a putative tumor suppressor gene in high-grade serous ovarian carcinoma and impacts cell survival after oxidative stress. Cell Death & Disease. 2016;7(9):e2374.  PubMed
Buckley, Melissa A; Woods, Nicholas T; Tyrer, Jonathan P; Mendoza-Fandiño, Gustavo; Lawrenson, Kate; Hazelett, Dennis J; Najafabadi, Hamed S; Gjyshi, Anxhela; Carvalho, Renato S; Lyra, Paulo C Jr; Coetzee, Simon G; Shen, Howard C; Yang, Ally W; Earp, Madalene A; Yoder, Sean J; Risch, Harvey; Chenevix-Trench, Georgia; Ramus, Susan J; Phelan, Catherine M; Coetzee, Gerhard A; Noushmehr, Houtan; Hughes, Timothy R; Sellers, Thomas A; Goode, Ellen L; Pharoah, Paul D; Gayther, Simon A; Monteiro, Alvaro N A. Functional Analysis and Fine Mapping of the 9p22.2 Ovarian Cancer Susceptibility Locus. Cancer Research. 2019;79(3):467-481.  PubMed