Anti BICC1 pAb (ATL-HPA070797)

Atlas Antibodies

Catalog No.:
ATL-HPA070797-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BicC family RNA binding protein 1
Gene Name: BICC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014329: 98%, ENSRNOG00000000614: 97%
Entrez Gene ID: 80114
Uniprot ID: Q9H694
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSNIKHIMQRTGAQIHFPDPSNPQKKSTVYLQGTIESVCLARQYLMGCLPLVLMFDMKEEIEV
Gene Sequence HLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSNIKHIMQRTGAQIHFPDPSNPQKKSTVYLQGTIESVCLARQYLMGCLPLVLMFDMKEEIEV
Gene ID - Mouse ENSMUSG00000014329
Gene ID - Rat ENSRNOG00000000614
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BICC1 pAb (ATL-HPA070797)
Datasheet Anti BICC1 pAb (ATL-HPA070797) Datasheet (External Link)
Vendor Page Anti BICC1 pAb (ATL-HPA070797) at Atlas Antibodies

Documents & Links for Anti BICC1 pAb (ATL-HPA070797)
Datasheet Anti BICC1 pAb (ATL-HPA070797) Datasheet (External Link)
Vendor Page Anti BICC1 pAb (ATL-HPA070797)