Anti BET1L pAb (ATL-HPA039819 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA039819-25
  • Immunohistochemistry analysis in human prostate and skeletal muscle tissues using HPA039819 antibody. Corresponding BET1L RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Bet1 golgi vesicular membrane trafficking protein-like
Gene Name: BET1L
Alternative Gene Name: GOLIM3, GS15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110136: 91%, ENSRNOG00000013165: 91%
Entrez Gene ID: 51272
Uniprot ID: Q9NYM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMDSDFTSMTSLLTGSVKRFSTMARSGQ
Gene Sequence MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMDSDFTSMTSLLTGSVKRFSTMARSGQ
Gene ID - Mouse ENSMUSG00000110136
Gene ID - Rat ENSRNOG00000013165
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BET1L pAb (ATL-HPA039819 w/enhanced validation)
Datasheet Anti BET1L pAb (ATL-HPA039819 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BET1L pAb (ATL-HPA039819 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BET1L pAb (ATL-HPA039819 w/enhanced validation)
Datasheet Anti BET1L pAb (ATL-HPA039819 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BET1L pAb (ATL-HPA039819 w/enhanced validation)