Anti BCKDHB pAb (ATL-HPA031956)

Atlas Antibodies

SKU: ATL-HPA031956-25

• 

Protein Description: branched chain keto acid dehydrogenase E1 subunit beta
Gene Name: BCKDHB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032263: 98%, ENSRNOG00000009928: 98%
Entrez Gene ID: 594
Uniprot ID: P21953
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDAL
• Gene Sequence: TIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDAL
• Gene ID - Mouse: ENSMUSG00000032263
• Gene ID - Rat: ENSRNOG00000009928
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.