Anti BACH1 pAb (ATL-HPA034949)

Atlas Antibodies

SKU:
ATL-HPA034949-25
  • Immunohistochemical staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: BTB and CNC homology 1, basic leucine zipper transcription factor 1
Gene Name: BACH1
Alternative Gene Name: BACH-1, BTBD24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025612: 97%, ENSRNOG00000001582: 96%
Entrez Gene ID: 571
Uniprot ID: O14867
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIIS
Gene Sequence LGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIIS
Gene ID - Mouse ENSMUSG00000025612
Gene ID - Rat ENSRNOG00000001582
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BACH1 pAb (ATL-HPA034949)
Datasheet Anti BACH1 pAb (ATL-HPA034949) Datasheet (External Link)
Vendor Page Anti BACH1 pAb (ATL-HPA034949) at Atlas Antibodies

Documents & Links for Anti BACH1 pAb (ATL-HPA034949)
Datasheet Anti BACH1 pAb (ATL-HPA034949) Datasheet (External Link)
Vendor Page Anti BACH1 pAb (ATL-HPA034949)



Citations for Anti BACH1 pAb (ATL-HPA034949) – 1 Found
Takemoto, Kenshiro; Kobatake, Kohei; Miura, Kento; Fukushima, Takafumi; Babasaki, Takashi; Miyamoto, Shunsuke; Sekino, Yohei; Kitano, Hiroyuki; Goto, Keisuke; Ikeda, Kenichiro; Hieda, Keisuke; Hayashi, Tetsutaro; Hinata, Nobuyuki; Kaminuma, Osamu. BACH1 promotes clear cell renal cell carcinoma progression by upregulating oxidative stress-related tumorigenicity. Cancer Science. 2023;114(2):436-448.  PubMed