Anti AZIN1 pAb (ATL-HPA027948)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027948-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AZIN1
Alternative Gene Name: OAZI, OAZIN, ODC1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037458: 97%, ENSRNOG00000005333: 94%
Entrez Gene ID: 51582
Uniprot ID: O14977
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYV |
Gene Sequence | AKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYV |
Gene ID - Mouse | ENSMUSG00000037458 |
Gene ID - Rat | ENSRNOG00000005333 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AZIN1 pAb (ATL-HPA027948) | |
Datasheet | Anti AZIN1 pAb (ATL-HPA027948) Datasheet (External Link) |
Vendor Page | Anti AZIN1 pAb (ATL-HPA027948) at Atlas Antibodies |
Documents & Links for Anti AZIN1 pAb (ATL-HPA027948) | |
Datasheet | Anti AZIN1 pAb (ATL-HPA027948) Datasheet (External Link) |
Vendor Page | Anti AZIN1 pAb (ATL-HPA027948) |