Anti AZIN1 pAb (ATL-HPA027948)

Atlas Antibodies

SKU: ATL-HPA027948-25

• 
• 

Protein Description: antizyme inhibitor 1
Gene Name: AZIN1
Alternative Gene Name: OAZI, OAZIN, ODC1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037458: 97%, ENSRNOG00000005333: 94%
Entrez Gene ID: 51582
Uniprot ID: O14977
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYV
• Gene Sequence: AKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYV
• Gene ID - Mouse: ENSMUSG00000037458
• Gene ID - Rat: ENSRNOG00000005333
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.