Anti AZIN1 pAb (ATL-HPA027948)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027948-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: AZIN1
Alternative Gene Name: OAZI, OAZIN, ODC1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037458: 97%, ENSRNOG00000005333: 94%
Entrez Gene ID: 51582
Uniprot ID: O14977
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYV |
| Gene Sequence | AKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYV |
| Gene ID - Mouse | ENSMUSG00000037458 |
| Gene ID - Rat | ENSRNOG00000005333 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AZIN1 pAb (ATL-HPA027948) | |
| Datasheet | Anti AZIN1 pAb (ATL-HPA027948) Datasheet (External Link) |
| Vendor Page | Anti AZIN1 pAb (ATL-HPA027948) at Atlas Antibodies |
| Documents & Links for Anti AZIN1 pAb (ATL-HPA027948) | |
| Datasheet | Anti AZIN1 pAb (ATL-HPA027948) Datasheet (External Link) |
| Vendor Page | Anti AZIN1 pAb (ATL-HPA027948) |