Anti ATF5 pAb (ATL-HPA030187)

Atlas Antibodies

SKU:
ATL-HPA030187-25
  • Immunohistochemical staining of human duodenum shows moderate nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ATF5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402139).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: activating transcription factor 5
Gene Name: ATF5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038539: 87%, ENSRNOG00000020060: 89%
Entrez Gene ID: 22809
Uniprot ID: Q9Y2D1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLAPYEVLGGALEGGLPVGGEPLAGDGFSDWMTERVDFTALLPLEPPLPPGTLPQPSPTPPDLEAMASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPVLDTLDL
Gene Sequence PLAPYEVLGGALEGGLPVGGEPLAGDGFSDWMTERVDFTALLPLEPPLPPGTLPQPSPTPPDLEAMASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPVLDTLDL
Gene ID - Mouse ENSMUSG00000038539
Gene ID - Rat ENSRNOG00000020060
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATF5 pAb (ATL-HPA030187)
Datasheet Anti ATF5 pAb (ATL-HPA030187) Datasheet (External Link)
Vendor Page Anti ATF5 pAb (ATL-HPA030187) at Atlas Antibodies

Documents & Links for Anti ATF5 pAb (ATL-HPA030187)
Datasheet Anti ATF5 pAb (ATL-HPA030187) Datasheet (External Link)
Vendor Page Anti ATF5 pAb (ATL-HPA030187)