Anti ASAH2 pAb (ATL-HPA061171)

Atlas Antibodies

Catalog No.: ATL-HPA061171-25

Protein Description: N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2
Gene Name: ASAH2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024887: 85%, ENSRNOG00000012196: 83%
Entrez Gene ID: 56624
Uniprot ID: Q9NR71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQNHQT
• Gene Sequence: RTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQNHQT
• Gene ID - Mouse: ENSMUSG00000024887
• Gene ID - Rat: ENSRNOG00000012196
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.