Anti ASAH2 pAb (ATL-HPA061171)

Atlas Antibodies

Catalog No.:
ATL-HPA061171-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2
Gene Name: ASAH2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024887: 85%, ENSRNOG00000012196: 83%
Entrez Gene ID: 56624
Uniprot ID: Q9NR71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQNHQT
Gene Sequence RTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQNHQT
Gene ID - Mouse ENSMUSG00000024887
Gene ID - Rat ENSRNOG00000012196
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ASAH2 pAb (ATL-HPA061171)
Datasheet Anti ASAH2 pAb (ATL-HPA061171) Datasheet (External Link)
Vendor Page Anti ASAH2 pAb (ATL-HPA061171) at Atlas Antibodies

Documents & Links for Anti ASAH2 pAb (ATL-HPA061171)
Datasheet Anti ASAH2 pAb (ATL-HPA061171) Datasheet (External Link)
Vendor Page Anti ASAH2 pAb (ATL-HPA061171)