Anti ARMT1 pAb (ATL-HPA003004 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA003004-100
  • Immunohistochemical staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, nuclear bodies & cytosol.
  • Western blot analysis in human cell line MCF-7 and human cell line PC-3.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: acidic residue methyltransferase 1
Gene Name: ARMT1
Alternative Gene Name: C6orf211, FLJ12910
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061759: 76%, ENSRNOG00000019489: 81%
Entrez Gene ID: 79624
Uniprot ID: Q9H993
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEAEKKAISLLSKLRNELQTDKPFIPLVEKFVDTDIWNQYLEYQQSLLNESDGKSRWFYSPWLLVECYMYRRIHEAIIQSPPIDYFDVFKESKEQNFYGSQESIIALCTHLQQLIRTIEDL
Gene Sequence VEAEKKAISLLSKLRNELQTDKPFIPLVEKFVDTDIWNQYLEYQQSLLNESDGKSRWFYSPWLLVECYMYRRIHEAIIQSPPIDYFDVFKESKEQNFYGSQESIIALCTHLQQLIRTIEDL
Gene ID - Mouse ENSMUSG00000061759
Gene ID - Rat ENSRNOG00000019489
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARMT1 pAb (ATL-HPA003004 w/enhanced validation)
Datasheet Anti ARMT1 pAb (ATL-HPA003004 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARMT1 pAb (ATL-HPA003004 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ARMT1 pAb (ATL-HPA003004 w/enhanced validation)
Datasheet Anti ARMT1 pAb (ATL-HPA003004 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARMT1 pAb (ATL-HPA003004 w/enhanced validation)