Anti AREL1 pAb (ATL-HPA051306)

Atlas Antibodies

Catalog No.:
ATL-HPA051306-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: apoptosis resistant E3 ubiquitin protein ligase 1
Gene Name: AREL1
Alternative Gene Name: KIAA0317
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042350: 92%, ENSRNOG00000004382: 93%
Entrez Gene ID: 9870
Uniprot ID: O15033
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVVPSKTKIVCHFSTLVLTCGQPHTLQIVPRDEYDNPTNNSMSLRDEHNYTLSIHELGPQEEESTGVSFEKSVTSNRQTFQVFLRLTL
Gene Sequence MVVPSKTKIVCHFSTLVLTCGQPHTLQIVPRDEYDNPTNNSMSLRDEHNYTLSIHELGPQEEESTGVSFEKSVTSNRQTFQVFLRLTL
Gene ID - Mouse ENSMUSG00000042350
Gene ID - Rat ENSRNOG00000004382
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AREL1 pAb (ATL-HPA051306)
Datasheet Anti AREL1 pAb (ATL-HPA051306) Datasheet (External Link)
Vendor Page Anti AREL1 pAb (ATL-HPA051306) at Atlas Antibodies

Documents & Links for Anti AREL1 pAb (ATL-HPA051306)
Datasheet Anti AREL1 pAb (ATL-HPA051306) Datasheet (External Link)
Vendor Page Anti AREL1 pAb (ATL-HPA051306)