Anti APC pAb (ATL-HPA013349)

Atlas Antibodies

SKU: ATL-HPA013349-25

• 

Protein Description: adenomatous polyposis coli
Gene Name: APC
Alternative Gene Name: DP2, DP2.5, DP3, PPP1R46
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005871: 89%, ENSRNOG00000020423: 87%
Entrez Gene ID: 324
Uniprot ID: P25054
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKP
• Gene Sequence: DNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKP
• Gene ID - Mouse: ENSMUSG00000005871
• Gene ID - Rat: ENSRNOG00000020423
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti APC pAb (ATL-HPA013349) – 1 Found

Matos, Irina; Asare, Amma; Levorse, John; Ouspenskaia, Tamara; de la Cruz-Racelis, June; Schuhmacher, Laura-Nadine; Fuchs, Elaine. Progenitors oppositely polarize WNT activators and inhibitors to orchestrate tissue development. Elife. 2020;9( 32310087)