Anti AP1S3 pAb (ATL-HPA066782)

Atlas Antibodies

SKU: ATL-HPA066782-25

• 
• 

Protein Description: adaptor-related protein complex 1, sigma 3 subunit
Gene Name: AP1S3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054702: 86%, ENSRNOG00000049873: 89%
Entrez Gene ID: 130340
Uniprot ID: Q96PC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRY
• Gene Sequence: ERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRY
• Gene ID - Mouse: ENSMUSG00000054702
• Gene ID - Rat: ENSRNOG00000049873
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.