Anti AOC1 pAb (ATL-HPA031032)
Atlas Antibodies
- SKU:
- ATL-HPA031032-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AOC1
Alternative Gene Name: ABP1, DAO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029811: 78%, ENSRNOG00000008575: 81%
Entrez Gene ID: 26
Uniprot ID: P19801
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TKPLHQFFLNTTGFSFQDCHDRCLAFTDVAPRGVASGQRRSWLIIQRYVEGYFLHPTGLELLVDHGSTDAGHWA |
Gene Sequence | TKPLHQFFLNTTGFSFQDCHDRCLAFTDVAPRGVASGQRRSWLIIQRYVEGYFLHPTGLELLVDHGSTDAGHWA |
Gene ID - Mouse | ENSMUSG00000029811 |
Gene ID - Rat | ENSRNOG00000008575 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AOC1 pAb (ATL-HPA031032) | |
Datasheet | Anti AOC1 pAb (ATL-HPA031032) Datasheet (External Link) |
Vendor Page | Anti AOC1 pAb (ATL-HPA031032) at Atlas Antibodies |
Documents & Links for Anti AOC1 pAb (ATL-HPA031032) | |
Datasheet | Anti AOC1 pAb (ATL-HPA031032) Datasheet (External Link) |
Vendor Page | Anti AOC1 pAb (ATL-HPA031032) |
Citations for Anti AOC1 pAb (ATL-HPA031032) – 1 Found |
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |