Anti AOC1 pAb (ATL-HPA031032)

Atlas Antibodies

Catalog No.:
ATL-HPA031032-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: amine oxidase, copper containing 1
Gene Name: AOC1
Alternative Gene Name: ABP1, DAO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029811: 78%, ENSRNOG00000008575: 81%
Entrez Gene ID: 26
Uniprot ID: P19801
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKPLHQFFLNTTGFSFQDCHDRCLAFTDVAPRGVASGQRRSWLIIQRYVEGYFLHPTGLELLVDHGSTDAGHWA
Gene Sequence TKPLHQFFLNTTGFSFQDCHDRCLAFTDVAPRGVASGQRRSWLIIQRYVEGYFLHPTGLELLVDHGSTDAGHWA
Gene ID - Mouse ENSMUSG00000029811
Gene ID - Rat ENSRNOG00000008575
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AOC1 pAb (ATL-HPA031032)
Datasheet Anti AOC1 pAb (ATL-HPA031032) Datasheet (External Link)
Vendor Page Anti AOC1 pAb (ATL-HPA031032) at Atlas Antibodies

Documents & Links for Anti AOC1 pAb (ATL-HPA031032)
Datasheet Anti AOC1 pAb (ATL-HPA031032) Datasheet (External Link)
Vendor Page Anti AOC1 pAb (ATL-HPA031032)
Citations for Anti AOC1 pAb (ATL-HPA031032) – 1 Found
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed