Anti ANKRD22 pAb (ATL-HPA012922)

Atlas Antibodies

SKU:
ATL-HPA012922-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line RT4 shows localization to nucleus.
  • Western blot analysis in human stomach tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 22
Gene Name: ANKRD22
Alternative Gene Name: MGC22805
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024774: 84%, ENSRNOG00000019190: 88%
Entrez Gene ID: 118932
Uniprot ID: Q5VYY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KTKQNEALVRMLLDAGVEVNATDCYGCTALHYACEMKNPSLIPLLLEARADPTIKNKHGESSLDIARRLKFSQIELMLRK
Gene Sequence KTKQNEALVRMLLDAGVEVNATDCYGCTALHYACEMKNPSLIPLLLEARADPTIKNKHGESSLDIARRLKFSQIELMLRK
Gene ID - Mouse ENSMUSG00000024774
Gene ID - Rat ENSRNOG00000019190
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKRD22 pAb (ATL-HPA012922)
Datasheet Anti ANKRD22 pAb (ATL-HPA012922) Datasheet (External Link)
Vendor Page Anti ANKRD22 pAb (ATL-HPA012922) at Atlas Antibodies

Documents & Links for Anti ANKRD22 pAb (ATL-HPA012922)
Datasheet Anti ANKRD22 pAb (ATL-HPA012922) Datasheet (External Link)
Vendor Page Anti ANKRD22 pAb (ATL-HPA012922)