Anti AMIGO2 pAb (ATL-HPA059601)

Atlas Antibodies

Catalog No.:
ATL-HPA059601-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: adhesion molecule with Ig-like domain 2
Gene Name: AMIGO2
Alternative Gene Name: ALI1, DEGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048218: 86%, ENSRNOG00000007032: 80%
Entrez Gene ID: 347902
Uniprot ID: Q86SJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CPCKCKTKRQKNMLHQSNAHSSILSPGPASDASADERKAGAGKRVVFLEPLKDTAAGQNGKVRLFPSEAVIAEGILKST
Gene Sequence CPCKCKTKRQKNMLHQSNAHSSILSPGPASDASADERKAGAGKRVVFLEPLKDTAAGQNGKVRLFPSEAVIAEGILKST
Gene ID - Mouse ENSMUSG00000048218
Gene ID - Rat ENSRNOG00000007032
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AMIGO2 pAb (ATL-HPA059601)
Datasheet Anti AMIGO2 pAb (ATL-HPA059601) Datasheet (External Link)
Vendor Page Anti AMIGO2 pAb (ATL-HPA059601) at Atlas Antibodies

Documents & Links for Anti AMIGO2 pAb (ATL-HPA059601)
Datasheet Anti AMIGO2 pAb (ATL-HPA059601) Datasheet (External Link)
Vendor Page Anti AMIGO2 pAb (ATL-HPA059601)