Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023296-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ALDH7A1
Alternative Gene Name: ATQ1, EPD, PDE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053644: 86%, ENSRNOG00000014645: 89%
Entrez Gene ID: 501
Uniprot ID: P49419
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTETFAPILY |
| Gene Sequence | DLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTETFAPILY |
| Gene ID - Mouse | ENSMUSG00000053644 |
| Gene ID - Rat | ENSRNOG00000014645 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) | |
| Datasheet | Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) | |
| Datasheet | Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) |
| Citations for Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) – 2 Found |
| Andrejeva, Diana; Kugler, Jan-Michael; Nguyen, Hung Thanh; Malmendal, Anders; Holm, Mette Lind; Toft, Birgitte Groenkaer; Loya, Anand C; Cohen, Stephen M. Metabolic control of PPAR activity by aldehyde dehydrogenase regulates invasive cell behavior and predicts survival in hepatocellular and renal clear cell carcinoma. Bmc Cancer. 2018;18(1):1180. PubMed |
| Lu, Hsueh-Ju; Hsieh, Chih-Cheng; Yeh, Chi-Chun; Yeh, Yi-Chen; Wu, Chun-Chi; Wang, Feng-Sheng; Lai, Jin-Mei; Yang, Muh-Hwa; Wang, Cheng-Hsu; Huang, Chi-Ying F; Chang, Peter Mu-Hsin. Clinical, pathophysiologic, and genomic analysis of the outcomes of primary head and neck malignancy after pulmonary metastasectomy. Scientific Reports. 2019;9(1):12913. PubMed |