Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023296-25

Protein Description: aldehyde dehydrogenase 7 family, member A1
Gene Name: ALDH7A1
Alternative Gene Name: ATQ1, EPD, PDE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053644: 86%, ENSRNOG00000014645: 89%
Entrez Gene ID: 501
Uniprot ID: P49419
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTETFAPILY
• Gene Sequence: DLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTETFAPILY
• Gene ID - Mouse: ENSMUSG00000053644
• Gene ID - Rat: ENSRNOG00000014645
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) – 2 Found

Andrejeva, Diana; Kugler, Jan-Michael; Nguyen, Hung Thanh; Malmendal, Anders; Holm, Mette Lind; Toft, Birgitte Groenkaer; Loya, Anand C; Cohen, Stephen M. Metabolic control of PPAR activity by aldehyde dehydrogenase regulates invasive cell behavior and predicts survival in hepatocellular and renal clear cell carcinoma. Bmc Cancer. 2018;18(1):1180. 

Lu, Hsueh-Ju; Hsieh, Chih-Cheng; Yeh, Chi-Chun; Yeh, Yi-Chen; Wu, Chun-Chi; Wang, Feng-Sheng; Lai, Jin-Mei; Yang, Muh-Hwa; Wang, Cheng-Hsu; Huang, Chi-Ying F; Chang, Peter Mu-Hsin. Clinical, pathophysiologic, and genomic analysis of the outcomes of primary head and neck malignancy after pulmonary metastasectomy. Scientific Reports. 2019;9(1):12913.