Anti ALDH18A1 pAb (ATL-HPA012604 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA012604-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: aldehyde dehydrogenase 18 family, member A1
Gene Name: ALDH18A1
Alternative Gene Name: GSAS, P5CS, PYCS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025007: 97%, ENSRNOG00000060047: 97%
Entrez Gene ID: 5832
Uniprot ID: P54886
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRD
Gene Sequence SVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRD
Gene ID - Mouse ENSMUSG00000025007
Gene ID - Rat ENSRNOG00000060047
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALDH18A1 pAb (ATL-HPA012604 w/enhanced validation)
Datasheet Anti ALDH18A1 pAb (ATL-HPA012604 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDH18A1 pAb (ATL-HPA012604 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ALDH18A1 pAb (ATL-HPA012604 w/enhanced validation)
Datasheet Anti ALDH18A1 pAb (ATL-HPA012604 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDH18A1 pAb (ATL-HPA012604 w/enhanced validation)
Citations for Anti ALDH18A1 pAb (ATL-HPA012604 w/enhanced validation) – 3 Found
Budge, James D; Roobol, Joanne; Singh, Gurdeep; Mozzanino, Théo; Knight, Tanya J; Povey, Jane; Dean, Andrew; Turner, Sarah J; Jaques, Colin M; Young, Robert J; Racher, Andrew J; Smales, C Mark. A proline metabolism selection system and its application to the engineering of lipid biosynthesis in Chinese hamster ovary cells. Metabolic Engineering Communications. 2021;13( 34386349):e00179.  PubMed
Craze, Madeleine L; Cheung, Hayley; Jewa, Natasha; Coimbra, Nuno D M; Soria, Daniele; El-Ansari, Rokaya; Aleskandarany, Mohammed A; Wai Cheng, Kiu; Diez-Rodriguez, Maria; Nolan, Christopher C; Ellis, Ian O; Rakha, Emad A; Green, Andrew R. MYC regulation of glutamine-proline regulatory axis is key in luminal B breast cancer. British Journal Of Cancer. 2018;118(2):258-265.  PubMed
Yang, Zhaoying; Zhao, Xiaocui; Shang, Weina; Liu, Yang; Ji, Jun-Feng; Liu, Jun-Ping; Tong, Chao. Pyrroline-5-carboxylate synthase senses cellular stress and modulates metabolism by regulating mitochondrial respiration. Cell Death And Differentiation. 2021;28(1):303-319.  PubMed