Anti ALCAM pAb (ATL-HPA010926 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA010926-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ALCAM
Alternative Gene Name: CD166, MEMD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022636: 94%, ENSRNOG00000001989: 93%
Entrez Gene ID: 214
Uniprot ID: Q13740
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKR |
Gene Sequence | NITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKR |
Gene ID - Mouse | ENSMUSG00000022636 |
Gene ID - Rat | ENSRNOG00000001989 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALCAM pAb (ATL-HPA010926 w/enhanced validation) | |
Datasheet | Anti ALCAM pAb (ATL-HPA010926 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ALCAM pAb (ATL-HPA010926 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ALCAM pAb (ATL-HPA010926 w/enhanced validation) | |
Datasheet | Anti ALCAM pAb (ATL-HPA010926 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ALCAM pAb (ATL-HPA010926 w/enhanced validation) |
Citations for Anti ALCAM pAb (ATL-HPA010926 w/enhanced validation) – 5 Found |
Tyekucheva, Svitlana; Bowden, Michaela; Bango, Clyde; Giunchi, Francesca; Huang, Ying; Zhou, Chensheng; Bondi, Arrigo; Lis, Rosina; Van Hemelrijck, Mieke; Andrén, Ove; Andersson, Sven-Olof; Watson, R William; Pennington, Stephen; Finn, Stephen P; Martin, Neil E; Stampfer, Meir J; Parmigiani, Giovanni; Penney, Kathryn L; Fiorentino, Michelangelo; Mucci, Lorelei A; Loda, Massimo. Stromal and epithelial transcriptional map of initiation progression and metastatic potential of human prostate cancer. Nature Communications. 2017;8(1):420. PubMed |
Kahlert, C; Weber, H; Mogler, C; Bergmann, F; Schirmacher, P; Kenngott, H G; Matterne, U; Mollberg, N; Rahbari, N N; Hinz, U; Koch, M; Aigner, M; Weitz, J. Increased expression of ALCAM/CD166 in pancreatic cancer is an independent prognostic marker for poor survival and early tumour relapse. British Journal Of Cancer. 2009;101(3):457-64. PubMed |
Ishiguro, Futoshi; Murakami, Hideki; Mizuno, Tetsuya; Fujii, Makiko; Kondo, Yutaka; Usami, Noriyasu; Taniguchi, Tetsuo; Yokoi, Kohei; Osada, Hirotaka; Sekido, Yoshitaka. Membranous expression of activated leukocyte cell adhesion molecule contributes to poor prognosis and malignant phenotypes of non-small-cell lung cancer. The Journal Of Surgical Research. 2013;179(1):24-32. PubMed |
Hansen, Amanda G; Freeman, Tanner J; Arnold, Shanna A; Starchenko, Alina; Jones-Paris, Celestial R; Gilger, Michael A; Washington, Mary K; Fan, Kang-Hsien; Shyr, Yu; Beauchamp, Robert D; Zijlstra, Andries. Elevated ALCAM shedding in colorectal cancer correlates with poor patient outcome. Cancer Research. 2013;73(10):2955-64. PubMed |
Nicolau-Neto, Pedro; de Souza-Santos, Paulo Thiago; Severo Ramundo, Mariana; Valverde, Priscila; Martins, Ivanir; Santos, Izabella Costa; Dias, Fernando; de Almeida Simão, Tatiana; Ribeiro Pinto, Luis Felipe. Transcriptome Analysis Identifies ALCAM Overexpression as a Prognosis Biomarker in Laryngeal Squamous Cell Carcinoma. Cancers. 2020;12(2) PubMed |