Anti AHNAK2 pAb (ATL-HPA004145 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA004145-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: AHNAK nucleoprotein 2
Gene Name: AHNAK2
Alternative Gene Name: C14orf78
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072812: 67%, ENSRNOG00000028545: 63%
Entrez Gene ID: 113146
Uniprot ID: Q8IVF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APRAKLDSAQLEGDLSLADKDVTAKDSKFKMPKFKMPSFGVSAPGKSIEASVHVSAPKVEADVSLPSMQGDLKTTDLSIQPHSADLTVQARQVDMKLLEGHVPEEAGLKGHLPKVQMPSFKMPKVDLKG
Gene Sequence APRAKLDSAQLEGDLSLADKDVTAKDSKFKMPKFKMPSFGVSAPGKSIEASVHVSAPKVEADVSLPSMQGDLKTTDLSIQPHSADLTVQARQVDMKLLEGHVPEEAGLKGHLPKVQMPSFKMPKVDLKG
Gene ID - Mouse ENSMUSG00000072812
Gene ID - Rat ENSRNOG00000028545
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AHNAK2 pAb (ATL-HPA004145 w/enhanced validation)
Datasheet Anti AHNAK2 pAb (ATL-HPA004145 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AHNAK2 pAb (ATL-HPA004145 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AHNAK2 pAb (ATL-HPA004145 w/enhanced validation)
Datasheet Anti AHNAK2 pAb (ATL-HPA004145 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AHNAK2 pAb (ATL-HPA004145 w/enhanced validation)
Citations for Anti AHNAK2 pAb (ATL-HPA004145 w/enhanced validation) – 4 Found
Fagerberg, Linn; Oksvold, Per; Skogs, Marie; Algenäs, Cajsa; Lundberg, Emma; Pontén, Fredrik; Sivertsson, Asa; Odeberg, Jacob; Klevebring, Daniel; Kampf, Caroline; Asplund, Anna; Sjöstedt, Evelina; Al-Khalili Szigyarto, Cristina; Edqvist, Per-Henrik; Olsson, Ingmarie; Rydberg, Urban; Hudson, Paul; Ottosson Takanen, Jenny; Berling, Holger; Björling, Lisa; Tegel, Hanna; Rockberg, Johan; Nilsson, Peter; Navani, Sanjay; Jirström, Karin; Mulder, Jan; Schwenk, Jochen M; Zwahlen, Martin; Hober, Sophia; Forsberg, Mattias; von Feilitzen, Kalle; Uhlén, Mathias. Contribution of antibody-based protein profiling to the human Chromosome-centric Proteome Project (C-HPP). Journal Of Proteome Research. 2013;12(6):2439-48.  PubMed
Lu, Di; Wang, Junxiong; Shi, Xiaoyan; Yue, Bing; Hao, Jianyu. AHNAK2 is a potential prognostic biomarker in patients with PDAC. Oncotarget. 2017;8(19):31775-31784.  PubMed
Zhang, Shusen; Lu, Yuanyuan; Qi, Lei; Wang, Hongyan; Wang, Zhihua; Cai, Zhigang. AHNAK2 Is Associated with Poor Prognosis and Cell Migration in Lung Adenocarcinoma. Biomed Research International. 2020( 32904605):8571932.  PubMed
Koguchi, Dai; Matsumoto, Kazumasa; Shimizu, Yuriko; Kobayashi, Momoko; Hirano, Shuhei; Ikeda, Masaomi; Sato, Yuichi; Iwamura, Masatsugu. Prognostic Impact of AHNAK2 Expression in Patients Treated with Radical Cystectomy. Cancers. 2021;13(8)  PubMed