Anti ADGRE1 pAb (ATL-HPA052809)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052809-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ADGRE1
Alternative Gene Name: EMR1, TM7LN3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004730: 76%, ENSRNOG00000046254: 68%
Entrez Gene ID: 2015
Uniprot ID: Q14246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMAN |
Gene Sequence | MNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMAN |
Gene ID - Mouse | ENSMUSG00000004730 |
Gene ID - Rat | ENSRNOG00000046254 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADGRE1 pAb (ATL-HPA052809) | |
Datasheet | Anti ADGRE1 pAb (ATL-HPA052809) Datasheet (External Link) |
Vendor Page | Anti ADGRE1 pAb (ATL-HPA052809) at Atlas Antibodies |
Documents & Links for Anti ADGRE1 pAb (ATL-HPA052809) | |
Datasheet | Anti ADGRE1 pAb (ATL-HPA052809) Datasheet (External Link) |
Vendor Page | Anti ADGRE1 pAb (ATL-HPA052809) |