Anti ADCK5 pAb (ATL-HPA028679 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA028679-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ADCK5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406404).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aarF domain containing kinase 5
Gene Name: ADCK5
Alternative Gene Name: FLJ35454
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022550: 81%, ENSRNOG00000030334: 82%
Entrez Gene ID: 203054
Uniprot ID: Q3MIX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence VLLDHGLYQFLEEKDRAALCQLWRAIILRDDAAMRAHAAALGVQDYLLFAEMLMQRPVRLGQLWGSHLLSREEAAYMVDMARERFEAVMAVLRELP
Gene ID - Mouse ENSMUSG00000022550
Gene ID - Rat ENSMUSG00000022550
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADCK5 pAb (ATL-HPA028679 w/enhanced validation)
Datasheet Anti ADCK5 pAb (ATL-HPA028679 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADCK5 pAb (ATL-HPA028679 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ADCK5 pAb (ATL-HPA028679 w/enhanced validation)
Datasheet Anti ADCK5 pAb (ATL-HPA028679 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADCK5 pAb (ATL-HPA028679 w/enhanced validation)