Anti ADAMTS10 pAb (ATL-HPA040223)

Atlas Antibodies

Catalog No.: ATL-HPA040223-25

Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 10
Gene Name: ADAMTS10
Alternative Gene Name: ADAM-TS10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024299: 91%, ENSRNOG00000008857: 94%
Entrez Gene ID: 81794
Uniprot ID: Q9H324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLIVMVLARTELPALRYRFNAPIARDSLPPYSWHYAPWTKCSAQCAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPK
• Gene Sequence: SLIVMVLARTELPALRYRFNAPIARDSLPPYSWHYAPWTKCSAQCAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPK
• Gene ID - Mouse: ENSMUSG00000024299
• Gene ID - Rat: ENSRNOG00000008857
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.