Anti ACP7 pAb (ATL-HPA042613)

Atlas Antibodies

Catalog No.: ATL-HPA042613-25

Protein Description: acid phosphatase 7, tartrate resistant (putative)
Gene Name: ACP7
Alternative Gene Name: FLJ16165, PAPL, PAPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037469: 81%, ENSRNOG00000047901: 76%
Entrez Gene ID: 390928
Uniprot ID: Q6ZNF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVHLSYPGEPGSMTVTWTTWVPTRSEVQFGLQPSGPLPLRAQGTFVPFVDGGILRRKLYIHRVTLRKLLPGVQYVYRCG
• Gene Sequence: QVHLSYPGEPGSMTVTWTTWVPTRSEVQFGLQPSGPLPLRAQGTFVPFVDGGILRRKLYIHRVTLRKLLPGVQYVYRCG
• Gene ID - Mouse: ENSMUSG00000037469
• Gene ID - Rat: ENSRNOG00000047901
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.