Anti ACP7 pAb (ATL-HPA042613)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042613-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ACP7
Alternative Gene Name: FLJ16165, PAPL, PAPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037469: 81%, ENSRNOG00000047901: 76%
Entrez Gene ID: 390928
Uniprot ID: Q6ZNF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QVHLSYPGEPGSMTVTWTTWVPTRSEVQFGLQPSGPLPLRAQGTFVPFVDGGILRRKLYIHRVTLRKLLPGVQYVYRCG |
Gene Sequence | QVHLSYPGEPGSMTVTWTTWVPTRSEVQFGLQPSGPLPLRAQGTFVPFVDGGILRRKLYIHRVTLRKLLPGVQYVYRCG |
Gene ID - Mouse | ENSMUSG00000037469 |
Gene ID - Rat | ENSRNOG00000047901 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACP7 pAb (ATL-HPA042613) | |
Datasheet | Anti ACP7 pAb (ATL-HPA042613) Datasheet (External Link) |
Vendor Page | Anti ACP7 pAb (ATL-HPA042613) at Atlas Antibodies |
Documents & Links for Anti ACP7 pAb (ATL-HPA042613) | |
Datasheet | Anti ACP7 pAb (ATL-HPA042613) Datasheet (External Link) |
Vendor Page | Anti ACP7 pAb (ATL-HPA042613) |