Anti ACD pAb (ATL-HPA057660)

Atlas Antibodies

Catalog No.:
ATL-HPA057660-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: adrenocortical dysplasia homolog (mouse)
Gene Name: ACD
Alternative Gene Name: Pip1, Ptop, Tint1, Tpp1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038000: 80%, ENSRNOG00000038973: 79%
Entrez Gene ID: 65057
Uniprot ID: Q96AP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVA
Gene Sequence IRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVA
Gene ID - Mouse ENSMUSG00000038000
Gene ID - Rat ENSRNOG00000038973
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACD pAb (ATL-HPA057660)
Datasheet Anti ACD pAb (ATL-HPA057660) Datasheet (External Link)
Vendor Page Anti ACD pAb (ATL-HPA057660) at Atlas Antibodies

Documents & Links for Anti ACD pAb (ATL-HPA057660)
Datasheet Anti ACD pAb (ATL-HPA057660) Datasheet (External Link)
Vendor Page Anti ACD pAb (ATL-HPA057660)