Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030217-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ABRACL
Alternative Gene Name: C6orf115, Costars, HSPC280, PRO2013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078453: 93%, ENSRNOG00000051450: 94%
Entrez Gene ID: 58527
Uniprot ID: Q9P1F3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD |
| Gene Sequence | NVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD |
| Gene ID - Mouse | ENSMUSG00000078453 |
| Gene ID - Rat | ENSRNOG00000051450 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation) | |
| Datasheet | Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation) | |
| Datasheet | Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation) |
| Citations for Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation) – 2 Found |
| Li, Jie; Chen, Hui. Actin-binding Rho activating C-terminal like (ABRACL) transcriptionally regulated by MYB proto-oncogene like 2 (MYBL2) promotes the proliferation, invasion, migration and epithelial-mesenchymal transition of breast cancer cells. Bioengineered. 2022;13(4):9019-9031. PubMed |
| Hsiao, Bo-Yuan; Chen, Chia-Hsin; Chi, Ho-Yi; Yen, Pei-Ru; Yu, Ying-Zhen; Lin, Chia-Hsin; Pang, Te-Ling; Lin, Wei-Chi; Li, Min-Lun; Yeh, Yi-Chen; Chou, Teh-Ying; Chen, Mei-Yu. Human Costars Family Protein ABRACL Modulates Actin Dynamics and Cell Migration and Associates with Tumorigenic Growth. International Journal Of Molecular Sciences. 2021;22(4) PubMed |