Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA030217-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ABRA C-terminal like
Gene Name: ABRACL
Alternative Gene Name: C6orf115, Costars, HSPC280, PRO2013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078453: 93%, ENSRNOG00000051450: 94%
Entrez Gene ID: 58527
Uniprot ID: Q9P1F3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen NVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD
Gene Sequence NVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD
Gene ID - Mouse ENSMUSG00000078453
Gene ID - Rat ENSRNOG00000051450
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation)
Datasheet Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation)
Datasheet Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation)
Citations for Anti ABRACL pAb (ATL-HPA030217 w/enhanced validation) – 2 Found
Li, Jie; Chen, Hui. Actin-binding Rho activating C-terminal like (ABRACL) transcriptionally regulated by MYB proto-oncogene like 2 (MYBL2) promotes the proliferation, invasion, migration and epithelial-mesenchymal transition of breast cancer cells. Bioengineered. 2022;13(4):9019-9031.  PubMed
Hsiao, Bo-Yuan; Chen, Chia-Hsin; Chi, Ho-Yi; Yen, Pei-Ru; Yu, Ying-Zhen; Lin, Chia-Hsin; Pang, Te-Ling; Lin, Wei-Chi; Li, Min-Lun; Yeh, Yi-Chen; Chou, Teh-Ying; Chen, Mei-Yu. Human Costars Family Protein ABRACL Modulates Actin Dynamics and Cell Migration and Associates with Tumorigenic Growth. International Journal Of Molecular Sciences. 2021;22(4)  PubMed