Anti ABHD8 pAb (ATL-HPA058209)

Atlas Antibodies

Catalog No.:
ATL-HPA058209-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 8
Gene Name: ABHD8
Alternative Gene Name: FLJ11743, MGC14280, MGC2512
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007950: 98%, ENSRNOG00000000054: 98%
Entrez Gene ID: 79575
Uniprot ID: Q96I13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFKRYAKKRNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTALEPSFCSI
Gene Sequence LGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFKRYAKKRNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTALEPSFCSI
Gene ID - Mouse ENSMUSG00000007950
Gene ID - Rat ENSRNOG00000000054
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABHD8 pAb (ATL-HPA058209)
Datasheet Anti ABHD8 pAb (ATL-HPA058209) Datasheet (External Link)
Vendor Page Anti ABHD8 pAb (ATL-HPA058209) at Atlas Antibodies

Documents & Links for Anti ABHD8 pAb (ATL-HPA058209)
Datasheet Anti ABHD8 pAb (ATL-HPA058209) Datasheet (External Link)
Vendor Page Anti ABHD8 pAb (ATL-HPA058209)