Anti ABHD8 pAb (ATL-HPA058209)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058209-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ABHD8
Alternative Gene Name: FLJ11743, MGC14280, MGC2512
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007950: 98%, ENSRNOG00000000054: 98%
Entrez Gene ID: 79575
Uniprot ID: Q96I13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFKRYAKKRNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTALEPSFCSI |
Gene Sequence | LGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFKRYAKKRNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTALEPSFCSI |
Gene ID - Mouse | ENSMUSG00000007950 |
Gene ID - Rat | ENSRNOG00000000054 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABHD8 pAb (ATL-HPA058209) | |
Datasheet | Anti ABHD8 pAb (ATL-HPA058209) Datasheet (External Link) |
Vendor Page | Anti ABHD8 pAb (ATL-HPA058209) at Atlas Antibodies |
Documents & Links for Anti ABHD8 pAb (ATL-HPA058209) | |
Datasheet | Anti ABHD8 pAb (ATL-HPA058209) Datasheet (External Link) |
Vendor Page | Anti ABHD8 pAb (ATL-HPA058209) |