Anti ABHD16A pAb (ATL-HPA058606)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058606-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ABHD16A
Alternative Gene Name: BAT5, D6S82E, NG26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007036: 91%, ENSRNOG00000056637: 93%
Entrez Gene ID: 7920
Uniprot ID: O95870
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPEDIM |
| Gene Sequence | GLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPEDIM |
| Gene ID - Mouse | ENSMUSG00000007036 |
| Gene ID - Rat | ENSRNOG00000056637 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABHD16A pAb (ATL-HPA058606) | |
| Datasheet | Anti ABHD16A pAb (ATL-HPA058606) Datasheet (External Link) |
| Vendor Page | Anti ABHD16A pAb (ATL-HPA058606) at Atlas Antibodies |
| Documents & Links for Anti ABHD16A pAb (ATL-HPA058606) | |
| Datasheet | Anti ABHD16A pAb (ATL-HPA058606) Datasheet (External Link) |
| Vendor Page | Anti ABHD16A pAb (ATL-HPA058606) |