Anti ABHD16A pAb (ATL-HPA058606)

Atlas Antibodies

Catalog No.:
ATL-HPA058606-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 16A
Gene Name: ABHD16A
Alternative Gene Name: BAT5, D6S82E, NG26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007036: 91%, ENSRNOG00000056637: 93%
Entrez Gene ID: 7920
Uniprot ID: O95870
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPEDIM
Gene Sequence GLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPEDIM
Gene ID - Mouse ENSMUSG00000007036
Gene ID - Rat ENSRNOG00000056637
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABHD16A pAb (ATL-HPA058606)
Datasheet Anti ABHD16A pAb (ATL-HPA058606) Datasheet (External Link)
Vendor Page Anti ABHD16A pAb (ATL-HPA058606) at Atlas Antibodies

Documents & Links for Anti ABHD16A pAb (ATL-HPA058606)
Datasheet Anti ABHD16A pAb (ATL-HPA058606) Datasheet (External Link)
Vendor Page Anti ABHD16A pAb (ATL-HPA058606)