Anti ABCF2 pAb (ATL-HPA020091 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA020091-25

• 
• 
• 

Protein Description: ATP-binding cassette, sub-family F (GCN20), member 2
Gene Name: ABCF2
Alternative Gene Name: ABC28, EST133090, HUSSY-18, M-ABC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028953: 93%, ENSRNOG00000010609: 97%
Entrez Gene ID: 10061
Uniprot ID: Q9UG63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKS
• Gene Sequence: KEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKS
• Gene ID - Mouse: ENSMUSG00000028953
• Gene ID - Rat: ENSRNOG00000010609
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.