Anti ABCF2 pAb (ATL-HPA020091 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA020091-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ABCF2
Alternative Gene Name: ABC28, EST133090, HUSSY-18, M-ABC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028953: 93%, ENSRNOG00000010609: 97%
Entrez Gene ID: 10061
Uniprot ID: Q9UG63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKS |
Gene Sequence | KEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKS |
Gene ID - Mouse | ENSMUSG00000028953 |
Gene ID - Rat | ENSRNOG00000010609 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABCF2 pAb (ATL-HPA020091 w/enhanced validation) | |
Datasheet | Anti ABCF2 pAb (ATL-HPA020091 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ABCF2 pAb (ATL-HPA020091 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ABCF2 pAb (ATL-HPA020091 w/enhanced validation) | |
Datasheet | Anti ABCF2 pAb (ATL-HPA020091 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ABCF2 pAb (ATL-HPA020091 w/enhanced validation) |