Anti ABCC11 pAb (ATL-HPA031981)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031981-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ABCC11
Alternative Gene Name: MRP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036872: 49%, ENSRNOG00000015666: 49%
Entrez Gene ID: 85320
Uniprot ID: Q96J66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RIGLETEAQFTAVERILQYMKMCVSEAPLHMEGTSCPQGWPQHGEIIFQDYHMKYRDNTPTVLHGINLTIRGHEVVGIV |
| Gene ID - Mouse | ENSMUSG00000036872 |
| Gene ID - Rat | ENSMUSG00000036872 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABCC11 pAb (ATL-HPA031981) | |
| Datasheet | Anti ABCC11 pAb (ATL-HPA031981) Datasheet (External Link) |
| Vendor Page | Anti ABCC11 pAb (ATL-HPA031981) at Atlas Antibodies |
| Documents & Links for Anti ABCC11 pAb (ATL-HPA031981) | |
| Datasheet | Anti ABCC11 pAb (ATL-HPA031981) Datasheet (External Link) |
| Vendor Page | Anti ABCC11 pAb (ATL-HPA031981) |