Anti ABCC11 pAb (ATL-HPA031981)

Atlas Antibodies

Catalog No.:
ATL-HPA031981-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family C (CFTR/MRP), member 11
Gene Name: ABCC11
Alternative Gene Name: MRP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036872: 49%, ENSRNOG00000015666: 49%
Entrez Gene ID: 85320
Uniprot ID: Q96J66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence RIGLETEAQFTAVERILQYMKMCVSEAPLHMEGTSCPQGWPQHGEIIFQDYHMKYRDNTPTVLHGINLTIRGHEVVGIV
Gene ID - Mouse ENSMUSG00000036872
Gene ID - Rat ENSMUSG00000036872
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABCC11 pAb (ATL-HPA031981)
Datasheet Anti ABCC11 pAb (ATL-HPA031981) Datasheet (External Link)
Vendor Page Anti ABCC11 pAb (ATL-HPA031981) at Atlas Antibodies

Documents & Links for Anti ABCC11 pAb (ATL-HPA031981)
Datasheet Anti ABCC11 pAb (ATL-HPA031981) Datasheet (External Link)
Vendor Page Anti ABCC11 pAb (ATL-HPA031981)