Anti ABCC11 pAb (ATL-HPA031980)

Atlas Antibodies

SKU: ATL-HPA031980-25

• 

Protein Description: ATP-binding cassette, sub-family C (CFTR/MRP), member 11
Gene Name: ABCC11
Alternative Gene Name: MRP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032446: 28%, ENSRNOG00000048101: 27%
Entrez Gene ID: 85320
Uniprot ID: Q96J66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSK
• Gene Sequence: ESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSK
• Gene ID - Mouse: ENSMUSG00000032446
• Gene ID - Rat: ENSRNOG00000048101
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.