Anti ABCC11 pAb (ATL-HPA031980)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031980-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ABCC11
Alternative Gene Name: MRP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032446: 28%, ENSRNOG00000048101: 27%
Entrez Gene ID: 85320
Uniprot ID: Q96J66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSK |
Gene Sequence | ESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSK |
Gene ID - Mouse | ENSMUSG00000032446 |
Gene ID - Rat | ENSRNOG00000048101 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABCC11 pAb (ATL-HPA031980) | |
Datasheet | Anti ABCC11 pAb (ATL-HPA031980) Datasheet (External Link) |
Vendor Page | Anti ABCC11 pAb (ATL-HPA031980) at Atlas Antibodies |
Documents & Links for Anti ABCC11 pAb (ATL-HPA031980) | |
Datasheet | Anti ABCC11 pAb (ATL-HPA031980) Datasheet (External Link) |
Vendor Page | Anti ABCC11 pAb (ATL-HPA031980) |