Anti ABCC11 pAb (ATL-HPA031980)

Atlas Antibodies

Catalog No.:
ATL-HPA031980-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family C (CFTR/MRP), member 11
Gene Name: ABCC11
Alternative Gene Name: MRP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032446: 28%, ENSRNOG00000048101: 27%
Entrez Gene ID: 85320
Uniprot ID: Q96J66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSK
Gene Sequence ESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSK
Gene ID - Mouse ENSMUSG00000032446
Gene ID - Rat ENSRNOG00000048101
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABCC11 pAb (ATL-HPA031980)
Datasheet Anti ABCC11 pAb (ATL-HPA031980) Datasheet (External Link)
Vendor Page Anti ABCC11 pAb (ATL-HPA031980) at Atlas Antibodies

Documents & Links for Anti ABCC11 pAb (ATL-HPA031980)
Datasheet Anti ABCC11 pAb (ATL-HPA031980) Datasheet (External Link)
Vendor Page Anti ABCC11 pAb (ATL-HPA031980)