Anti AAED1 pAb (ATL-HPA021294)

Atlas Antibodies

Catalog No.:
ATL-HPA021294-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: AhpC/TSA antioxidant enzyme domain containing 1
Gene Name: AAED1
Alternative Gene Name: C9orf21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021482: 93%, ENSRNOG00000018886: 92%
Entrez Gene ID: 195827
Uniprot ID: Q7RTV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQ
Gene Sequence SFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQ
Gene ID - Mouse ENSMUSG00000021482
Gene ID - Rat ENSRNOG00000018886
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AAED1 pAb (ATL-HPA021294)
Datasheet Anti AAED1 pAb (ATL-HPA021294) Datasheet (External Link)
Vendor Page Anti AAED1 pAb (ATL-HPA021294) at Atlas Antibodies

Documents & Links for Anti AAED1 pAb (ATL-HPA021294)
Datasheet Anti AAED1 pAb (ATL-HPA021294) Datasheet (External Link)
Vendor Page Anti AAED1 pAb (ATL-HPA021294)