Anti ZGRF1 pAb (ATL-HPA030706)

Atlas Antibodies

Catalog No.: ATL-HPA030706-25

Protein Description: zinc finger, GRF-type containing 1
Gene Name: ZGRF1
Alternative Gene Name: C4orf21, FLJ11331
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051278: 90%, ENSRNOG00000036980: 92%
Entrez Gene ID: 55345
Uniprot ID: Q86YA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESEQLKELHALMKEDLTPTERVYVRKSIEQHKLGTNRTLLKQVRVVGVTCAACPFPCMNDLKFPVVVLDECSQITEPASLLPIARFEC
• Gene Sequence: ESEQLKELHALMKEDLTPTERVYVRKSIEQHKLGTNRTLLKQVRVVGVTCAACPFPCMNDLKFPVVVLDECSQITEPASLLPIARFEC
• Gene ID - Mouse: ENSMUSG00000051278
• Gene ID - Rat: ENSRNOG00000036980
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.