Anti UBR2 pAb (ATL-HPA027880)

Atlas Antibodies

Catalog No.:
ATL-HPA027880-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ubiquitin protein ligase E3 component n-recognin 2
Gene Name: UBR2
Alternative Gene Name: bA49A4.1, C6orf133, dJ392M17.3, KIAA0349
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023977: 91%, ENSRNOG00000015813: 94%
Entrez Gene ID: 23304
Uniprot ID: Q8IWV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCGRV
Gene Sequence MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCGRV
Gene ID - Mouse ENSMUSG00000023977
Gene ID - Rat ENSRNOG00000015813
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBR2 pAb (ATL-HPA027880)
Datasheet Anti UBR2 pAb (ATL-HPA027880) Datasheet (External Link)
Vendor Page Anti UBR2 pAb (ATL-HPA027880) at Atlas Antibodies

Documents & Links for Anti UBR2 pAb (ATL-HPA027880)
Datasheet Anti UBR2 pAb (ATL-HPA027880) Datasheet (External Link)
Vendor Page Anti UBR2 pAb (ATL-HPA027880)