Anti SLC29A1 pAb (ATL-HPA012384)

Atlas Antibodies

Catalog No.: ATL-HPA012384-25

Protein Description: solute carrier family 29 (equilibrative nucleoside transporter), member 1
Gene Name: SLC29A1
Alternative Gene Name: ENT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023942: 72%, ENSRNOG00000019752: 70%
Entrez Gene ID: 2030
Uniprot ID: Q99808
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESHSIKAILK
• Gene Sequence: RLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESHSIKAILK
• Gene ID - Mouse: ENSMUSG00000023942
• Gene ID - Rat: ENSRNOG00000019752
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.