Anti SCN5A pAb (ATL-HPA063346)

Atlas Antibodies

SKU: ATL-HPA063346-25

• 

Protein Description: sodium voltage-gated channel alpha subunit 5
Gene Name: SCN5A
Alternative Gene Name: CDCD2, CMD1E, CMPD2, HB1, HB2, HBBD, HH1, ICCD, IVF, LQT3, Nav1.5, PFHB1, SSS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032511: 84%, ENSRNOG00000015049: 86%
Entrez Gene ID: 6331
Uniprot ID: Q14524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTS
• Gene Sequence: HKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTS
• Gene ID - Mouse: ENSMUSG00000032511
• Gene ID - Rat: ENSRNOG00000015049
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.