Anti SCN5A pAb (ATL-HPA063346)

Atlas Antibodies

Catalog No.:
ATL-HPA063346-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: sodium voltage-gated channel alpha subunit 5
Gene Name: SCN5A
Alternative Gene Name: CDCD2, CMD1E, CMPD2, HB1, HB2, HBBD, HH1, ICCD, IVF, LQT3, Nav1.5, PFHB1, SSS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032511: 84%, ENSRNOG00000015049: 86%
Entrez Gene ID: 6331
Uniprot ID: Q14524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTS
Gene Sequence HKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTS
Gene ID - Mouse ENSMUSG00000032511
Gene ID - Rat ENSRNOG00000015049
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCN5A pAb (ATL-HPA063346)
Datasheet Anti SCN5A pAb (ATL-HPA063346) Datasheet (External Link)
Vendor Page Anti SCN5A pAb (ATL-HPA063346) at Atlas Antibodies

Documents & Links for Anti SCN5A pAb (ATL-HPA063346)
Datasheet Anti SCN5A pAb (ATL-HPA063346) Datasheet (External Link)
Vendor Page Anti SCN5A pAb (ATL-HPA063346)