Anti RNF125 pAb (ATL-HPA041514)

Atlas Antibodies

Catalog No.: ATL-HPA041514-25

Protein Description: ring finger protein 125, E3 ubiquitin protein ligase
Gene Name: RNF125
Alternative Gene Name: FLJ20456
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033107: 51%, ENSRNOG00000057832: 88%
Entrez Gene ID: 54941
Uniprot ID: Q96EQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCP
• Gene Sequence: CIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCP
• Gene ID - Mouse: ENSMUSG00000033107
• Gene ID - Rat: ENSRNOG00000057832
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RNF125 pAb (ATL-HPA041514) – 1 Found

Kim, Hyungsoo; Frederick, Dennie T; Levesque, Mitchell P; Cooper, Zachary A; Feng, Yongmei; Krepler, Clemens; Brill, Laurence; Samuels, Yardena; Hayward, Nicholas K; Perlina, Ally; Piris, Adriano; Zhang, Tongwu; Halaban, Ruth; Herlyn, Meenhard M; Brown, Kevin M; Wargo, Jennifer A; Dummer, Reinhard; Flaherty, Keith T; Ronai, Ze'ev A. Downregulation of the Ubiquitin Ligase RNF125 Underlies Resistance of Melanoma Cells to BRAF Inhibitors via JAK1 Deregulation. Cell Reports. 2015;11(9):1458-73.