Anti PRKCH pAb (ATL-HPA026294)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026294-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PRKCH
Alternative Gene Name: PKC-L, PKCL, PRKCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021108: 98%, ENSRNOG00000004873: 97%
Entrez Gene ID: 5583
Uniprot ID: P24723
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNF |
Gene Sequence | FKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNF |
Gene ID - Mouse | ENSMUSG00000021108 |
Gene ID - Rat | ENSRNOG00000004873 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRKCH pAb (ATL-HPA026294) | |
Datasheet | Anti PRKCH pAb (ATL-HPA026294) Datasheet (External Link) |
Vendor Page | Anti PRKCH pAb (ATL-HPA026294) at Atlas Antibodies |
Documents & Links for Anti PRKCH pAb (ATL-HPA026294) | |
Datasheet | Anti PRKCH pAb (ATL-HPA026294) Datasheet (External Link) |
Vendor Page | Anti PRKCH pAb (ATL-HPA026294) |