Anti MTCH1 pAb (ATL-HPA015971)

Atlas Antibodies

Catalog No.: ATL-HPA015971-25

Protein Description: mitochondrial carrier 1
Gene Name: MTCH1
Alternative Gene Name: CGI-64, PSAP, SLC25A49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024012: 100%, ENSRNOG00000000527: 100%
Entrez Gene ID: 23787
Uniprot ID: Q9NZJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLLAHFINAYLVDDSVSDTPGGLGNDQNPGSQFSQALAIRSYTK
• Gene Sequence: NLLAHFINAYLVDDSVSDTPGGLGNDQNPGSQFSQALAIRSYTK
• Gene ID - Mouse: ENSMUSG00000024012
• Gene ID - Rat: ENSRNOG00000000527
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.