Anti MTCH1 pAb (ATL-HPA015971)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015971-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MTCH1
Alternative Gene Name: CGI-64, PSAP, SLC25A49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024012: 100%, ENSRNOG00000000527: 100%
Entrez Gene ID: 23787
Uniprot ID: Q9NZJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NLLAHFINAYLVDDSVSDTPGGLGNDQNPGSQFSQALAIRSYTK |
Gene Sequence | NLLAHFINAYLVDDSVSDTPGGLGNDQNPGSQFSQALAIRSYTK |
Gene ID - Mouse | ENSMUSG00000024012 |
Gene ID - Rat | ENSRNOG00000000527 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MTCH1 pAb (ATL-HPA015971) | |
Datasheet | Anti MTCH1 pAb (ATL-HPA015971) Datasheet (External Link) |
Vendor Page | Anti MTCH1 pAb (ATL-HPA015971) at Atlas Antibodies |
Documents & Links for Anti MTCH1 pAb (ATL-HPA015971) | |
Datasheet | Anti MTCH1 pAb (ATL-HPA015971) Datasheet (External Link) |
Vendor Page | Anti MTCH1 pAb (ATL-HPA015971) |