Anti MPRIP pAb (ATL-HPA022901 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA022901-25

Protein Description: myosin phosphatase Rho interacting protein
Gene Name: MPRIP
Alternative Gene Name: M-RIP, p116Rip, RHOIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005417: 97%, ENSRNOG00000003226: 97%
Entrez Gene ID: 23164
Uniprot ID: Q6WCQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KDAYELEVLLRVKESEIQYLKQEISSLKDELQTALRDKKYASDKYKDIYTELSIAKAKADCDISRLKEQLKAATEALGEKSPDSATVSGYDIMKSKSNPDFLKKDRSCVTRQL
• Gene Sequence: KDAYELEVLLRVKESEIQYLKQEISSLKDELQTALRDKKYASDKYKDIYTELSIAKAKADCDISRLKEQLKAATEALGEKSPDSATVSGYDIMKSKSNPDFLKKDRSCVTRQL
• Gene ID - Mouse: ENSMUSG00000005417
• Gene ID - Rat: ENSRNOG00000003226
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MPRIP pAb (ATL-HPA022901 w/enhanced validation) – 2 Found

Bracken, Cameron P; Li, Xiaochun; Wright, Josephine A; Lawrence, David M; Pillman, Katherine A; Salmanidis, Marika; Anderson, Matthew A; Dredge, B Kate; Gregory, Philip A; Tsykin, Anna; Neilsen, Corine; Thomson, Daniel W; Bert, Andrew G; Leerberg, Joanne M; Yap, Alpha S; Jensen, Kirk B; Khew-Goodall, Yeesim; Goodall, Gregory J. Genome-wide identification of miR-200 targets reveals a regulatory network controlling cell invasion. The Embo Journal. 2014;33(18):2040-56. 

Sztacho, Martin; Šalovská, Barbora; Červenka, Jakub; Balaban, Can; Hoboth, Peter; Hozák, Pavel. Limited Proteolysis-Coupled Mass Spectrometry Identifies Phosphatidylinositol 4,5-Bisphosphate Effectors in Human Nuclear Proteome. Cells. 2021;10(1)